A solution of 5-HMF (1 mmol, 0.126 g) in deionized water (7 mL) was prepared in a glass reactor, where 0.05 g of the catalyst under study and a magnetic stirrer w...
version "7.1.6" resolved "http://registry.npm.taobao.org/@babel/preset-env/download/@babel/preset-env-7.1.6.tgz#a0bf4b96b6bfcf6e000afc5b72b4abe7cc13ae97" integr...
WORLD-WIDE WEB This list can be acessed via our WWW page: http://pdg.lbl.gov/information.html For other lists of WWW home pages for HEP-related institutions: CERN...
GEIYPISGRTNYNEKFKVKATLTVDTSSSTAYMDLNSLTSEDSAVYYCA RSRANWDDYWGQGTTLTVSS. The following amino acid sequence comprises the framework regions and complementarity-dete...
WORLD-WIDE WEB This list can be acessed via our WWW page: http://pdg.lbl.gov/information.html For other lists of WWW home pages for HEP-related institutions: CERN...